On Brand / How work gets passed down, and what changes on the way

Internet exposure · PG-02

Once private material is online, control is lost

Digital publication converts private material into persistent public material that other people copy and reinterpret.

Established interpretationreuses the mechanism ofinternetprivacyleakimagesemailexposurepermanence

What this relationship type claims

reuses the mechanism of. A repeatable dramatic device recurs while surface content changes. Distinct from plot-mirror, which aligns a whole sequence of beats.

Read from the other side, the same record says supplies the mechanism for. There is one record here, not two. Chronology rule for this type: Source must predate target. Violation is a hard validation error.

Chronology

The earlier side

Joe circulates doctored sexual images of Catherine and Bill and explains that material placed on the internet cannot simply be removed.

The research describes this side rather than quoting it, so no exact script anchor is attached. The episode link above still resolves.

The later side

Hacked private emails become public, summarized by media, torrented, discussed by the group, and repackaged as branded content.

Described rather than quoted in the source research.

What changes on the way

Doctored-image prank becomes institution-wide privacy and media crisis.

The changed element is part of the evidence rather than noise. A function can move to a different character, a power relation can reverse, several sources can combine, and the same mechanism can produce a different result.

How this record is graded

Established interpretation Combines several matching elements across text, performance, production, or reception.

The source research wrote this status as: “Strong thematic and technology precursor

Sources

  1. Community ↔ NewsRadio Trope, Concept & Dialogue Index, Project research (Google Sheets), 2026-09-22 — row PG-02What it proves: Nothing on its own. It is the project's row-level index of mechanisms, each row carrying its own evidence status.